SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012535 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012535
Domain Number 1 Region: 2-77,117-202,231-259,327-434
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-61
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0039
Further Details:      
 
Domain Number 2 Region: 296-342
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000183
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012535   Gene: ENSSSCG00000011765   Transcript: ENSSSCT00000012876
Sequence length 436
Comment pep:known chromosome:Sscrofa10.2:13:126874048:126917846:1 gene:ENSSSCG00000011765 transcript:ENSSSCT00000012876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEERIQCCQTR
KVRYMERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIPFSACLQA
FSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFDVSIDMPD
LLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSEIDESSVMQLAEMGFP
LEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFGATGLDNQ
PPEEIVAIITSMGFHRNQAVQALRATNSNLERALDWIFSHPEFEEDSDFVIEMENNANAN
IISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYVCHIKKEGRWVIYNDHKVCASER
PPKDLGYMYFYRRIPS
Download sequence
Identical sequences ENSSSCP00000012535 ENSSSCP00000012535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]