SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012556 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012556
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-71
Family Ephrin receptor ligand binding domain 0.000000285
Further Details:      
 
Domain Number 2 Region: 296-504
Classification Level Classification E-value
Superfamily Fibronectin type III 4.47e-40
Family Fibronectin type III 0.0000864
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012556
Domain Number - Region: 226-300,335-357
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000259
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012556   Gene: ENSSSCG00000011785   Transcript: ENSSSCT00000012897
Sequence length 612
Comment pep:novel chromosome:Sscrofa10.2:13:132102677:132111733:-1 gene:ENSSSCG00000011785 transcript:ENSSSCT00000012897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKWVTSELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDV
QRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAP
DESFSRLDAGRVNTKVRSFGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALF
PETLTGAEPTSLVIAPGTCIANAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKES
QCRPCPPGSYKAKQGEGPCLPCPPNSRTTAPAASICTCHNNFYRADSDSADAACTTVPSP
PRGVISNVNETTLILEWSEPRDLGGRDDLLYNVICKKCHGSPGAGGAMTCSRCDDNVEFV
PRQLGLTERRVHISHLLAHTRYTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTL
HLHSSSGSSLTLSWTPPERPNGVILDYEMKYFEKSEGIASTVTSQKNSVQLDGLRPDARY
VVQVRARTVAGYGQYSRPAEFETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAV
VCLRKQRHGPDSEYTEKLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVI
GAGESPPPGTVG
Download sequence
Identical sequences ENSSSCP00000012556 ENSSSCP00000012556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]