SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012565 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012565
Domain Number 1 Region: 368-590
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.37e-78
Family Adenain-like 0.000000000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012565   Gene: ENSSSCG00000011794   Transcript: ENSSSCT00000012906
Sequence length 592
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:132968204:133008636:1 gene:ENSSSCG00000011794 transcript:ENSSSCT00000012906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKWLVRILGTIFRFCDRPVPSSRALLKRRRSNSSLFSTVDTDEVPAKRPRLDCFIHQVK
TSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEFFSYLSMCEESGIVTFYNYKCIL
KIGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLSSEGYNRRPGGRRHSKGHPESSLT
WKPQEQVVTEMISEEGGKGLRRPHCTVEEGVQKEEREKYRRLLERLKEGGHGNSVPPVTS
THHGSQRSQMDTLKTKSWGEEQSHGVRTTQFVPKQYRVVETRGPLCSVRSEKRCSKGKIS
DTEKTVGIRLDNESRRGHQLEPDLSEEVSARLRLGSGSNGLLRRKMSILETKEKNCSGKE
RDKRTEDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVIN
FYMNLLMERNKKQGYPALYAFSTFFYPKLKSGGYQAVKRWTKGVNLFEQELILVPIHRKV
HWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNIDLNLLEWTHYSLKPH
EIPQQLNGSDCGMFTCKYADYVSRDRPITFTQHQMPLFRKKMVWEILHQQLL
Download sequence
Identical sequences ENSSSCP00000012565 9823.ENSSSCP00000012565 ENSSSCP00000012565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]