SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012577 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012577
Domain Number 1 Region: 401-716
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.77e-77
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 24-138
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-34
Family Spermadhesin, CUB domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 184-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-32
Family Spermadhesin, CUB domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 300-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000878
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012577   Gene: ENSSSCG00000011806   Transcript: ENSSSCT00000012918
Sequence length 728
Comment pep:known chromosome:Sscrofa10.2:13:134301569:134349594:1 gene:ENSSSCG00000011806 transcript:ENSSSCT00000012918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLLSHALCFSLLKASAHVVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGKETTDTEQTPGQEVVFSPGSFMSITFRS
DFSNEERYTGFDAHYMAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDYPSPYPKSSECLYTIELEEGFMVSLQFEDIFDIEDHPEV
SCPYDYIKIKAGPKLLGPFCGEKAPEPINTQSHSIQIQFRSDNSGENRGWRLLYRATGNE
CPKLQPPVHGKIEPLQAKYSFKDQVLISCDTGYKVLKDNVEMDVFQIECLKDGTWSNKIP
TCKIADCGTPAKLENGLVTFSTRNNLTTYKSEIIYSCQQPYYKMLHSTTGVYTCSAQGVW
MNEVLGKSQPTCLPVCGQPSRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKW
FGSGALLSESWILTAAHVLRSQRRDNTVTPVSKEHVTVYLGLHDVRDKSGAVNSSAARVV
LHPDFDIQNYNHDIALVQLQEPVPLGPHVMPVCLPRPEPEGPAPHMLGLVAGWGISNPNV
TVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTC
LGDSGGAFVILDDLSQRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGSPPG
LGELQVER
Download sequence
Identical sequences D5L7X4
ENSSSCP00000012577 ENSSSCP00000023980 NP_001171876.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]