SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012591 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000012591
Domain Number - Region: 12-52
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00902
Family NlpC/P60 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012591   Gene: ENSSSCG00000011820   Transcript: ENSSSCT00000012932
Sequence length 169
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:139804583:139825723:1 gene:ENSSSCG00000011820 transcript:ENSSSCT00000012932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNDCFSLNYPGNPRPGDLIEVFRPGYQHWALYLGDGYVINIAPLEDGISTSFTSAKSI
FSTKALVKMQLLKDVVGNDTFRINNKYDDTYAPLPVEEVMQRSEFVIGQEVEYDIFVNNC
EHFVTLLRYGAGISEQANRAISTIGFVTAAAGAFSFLGLFPKRLRAKYY
Download sequence
Identical sequences A0A286ZPI9
9823.ENSSSCP00000012591 ENSSSCP00000012591 XP_020925718.1.46622 ENSSSCP00000012591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]