SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012608 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012608
Domain Number 1 Region: 364-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.6e-113
Family Transferrin 0.000000438
Further Details:      
 
Domain Number 2 Region: 22-346
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.43e-110
Family Transferrin 0.000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012608   Gene: ENSSSCG00000011837   Transcript: ENSSSCT00000012949
Sequence length 736
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:142726305:142751740:1 gene:ENSSSCG00000011837 transcript:ENSSSCT00000012949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPNVALWLCLALRTALGGMEVRWCTISDPEQQKCSDMSKAFQEAGIQPSLLCVQGTSA
DHCVQLITAREADAITLDGGAIYEAGKEHSLKPVVGEVYDQEVGTSYYAVAVVKRGSRVT
INTLKGMKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGDTS
YSESLCRLCRGNTAGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFELLCRDGSRADVTEWRRCHLARVPSHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSDAYGQKNLLFKDATSELVPIATQTYEAWLGEYEQAHEGLLCDPNG
LPHYLRWCVLSTPEIQKCGDMAVAFSRQRLKPEIQCVSADSPQHCMERIQAGHIDAVTLR
GEDIYMAGKTYGLVPAAGEHYAPEDRSNSYFVVAVVKRNSSYAFTLDELRGKRSCHPGFG
SLAGWDIPVGALVQRGFIRPRDCDVLTAVSEFFSASCVPVNNPKNYPSSLCALCVGDEQG
RNKCVGNSQERYYGYSGAFRCLVENAGDVAFVKHTTVFDNTNGHNSEPWAAVLMSEDYEL
LCPNGARAEVTQFTACNLAQIPSQAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMF
DSSNYHGQDLLFKDATIRVVPVGERTTYRDWLGPDYVAALEGMLSQQCSGAAVTASGVSL
LLLPLALTAGLLQPSL
Download sequence
Identical sequences ENSSSCP00000012608 ENSSSCP00000012608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]