SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012612 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012612
Domain Number 1 Region: 546-749
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-57
Family Adenain-like 0.00000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012612   Gene: ENSSSCG00000011841   Transcript: ENSSSCT00000012953
Sequence length 752
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:142805249:142869979:1 gene:ENSSSCG00000011841 transcript:ENSSSCT00000012953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQKKILWRKGIHLAFSERWNTGFGSFKKFCFHQHLCILKAKLGRPVTWSRHLRHFQCR
KKALQIQKKWIQHEPLFARTKSNVAAQNLRTLSSKVKRKGTKNLSSSSRTVLKLQAEKLL
SSAKNSDHEYCGEKSFLKAVADLPENSVLGQANGHRSRTEPQASGFPMKFSGETPSPGES
GTIVVTLSNHKRKGFCYGCCQRPEHRRNGGRLIPKKFHLNQHRRIKVSPHMMYEKLSMIR
FRYRILRSQHFRAKNKVCKLKKAQRSWVQVTGDHQETLRENGEGGTCSPFPSSEPKDPSC
RHQPYLPDMDSGAVVKGKNSHVPDGHTKGSPLLGKELSLGEAFPDQQNGNATYTWDQSPC
SSPKWECTELIHDIPLPEHHSSNAFISEAEREALSQENQTSTVSDDRVKLSMSGADPPVS
SVDGPVSEETVHNESSCQMDEDGSLKQNILSSKLLDHPYCKSPLEAPLTCSGLKLENQVG
GGKNSQKASPVDDEQLSICLSGFLDEVMKKYGSLVPLSEKDVLGRLKDVFNEDFSNRKPF
INREITNYRARHQKCNFRVFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKV
HFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSHLLIPIHLEVHWSLITVTLSNRIISFYD
SQGIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKC
LALEQPFQFSQEDMPRVRKRIYKELCECRLMD
Download sequence
Identical sequences 9823.ENSSSCP00000012612 ENSSSCP00000012612 ENSSSCP00000012612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]