SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012633 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000012633
Domain Number - Region: 15-55
Classification Level Classification E-value
Superfamily SEA domain 0.0157
Family SEA domain 0.013
Further Details:      
 
Domain Number - Region: 157-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0511
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 114-204
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0863
Family Growth factor receptor domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012633   Gene: ENSSSCG00000011862   Transcript: ENSSSCT00000012975
Sequence length 301
Comment pep:known chromosome:Sscrofa10.2:13:144997701:145020693:1 gene:ENSSSCG00000011862 transcript:ENSSSCT00000012975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKIFPGKITVKISETTDLEHENSVTYQNLYLQVTNFFNDTFSNSEYGQTVILKVSTTPSA
RYEMRASNQLVEVEVVNIFRETTTENESSIFNAIDQAIKSNPSDFTEYIQQDRCDYYGCK
RQNEQDECPSGLLCECKEGLERPNPQIPLCVALGPACSDTCNAENNRQCLVRSAGNAECL
CLPGYKEDKNKICRACPFGYSGVGCENPYQLILTIVGTIAGILILSLVIAFVLSLRSNNK
NKNVEEQNLIENYFQNLQLQETGFSNLGAGNLFPKIKVDLSRDDQPQSPYITQGSIPRPD
Y
Download sequence
Identical sequences 9823.ENSSSCP00000012633 ENSSSCP00000012633 ENSSSCP00000012633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]