SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012644 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012644
Domain Number 1 Region: 4-406
Classification Level Classification E-value
Superfamily Sema domain 4.84e-131
Family Sema domain 0.000000155
Further Details:      
 
Domain Number 2 Region: 699-751
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000327
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 511-561
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000798
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 754-811
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 5 Region: 402-451
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000122
Family Plexin repeat 0.0048
Further Details:      
 
Domain Number 6 Region: 565-617
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000123
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 7 Region: 814-857
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012644
Domain Number - Region: 456-508
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000209
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012644   Gene: ENSSSCG00000011872   Transcript: ENSSSCT00000012986
Sequence length 997
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:147291506:147312021:-1 gene:ENSSSCG00000011872 transcript:ENSSSCT00000012986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLPQATEWASNEDTRRSCQSKGKTEEECQNYVRVLIVTGRKVFMCGTNAFSPVCSSRQV
GNLSRTVEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLR
TAQYNSKWLNEPNFVAAFDIGLFAYFFLRENAVEHDCGRTVYSRVARVCKNDVGGRFLLE
DTWTTFMKARLNCSRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLS
AISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPEVGPNENLTERSLQDAQRLFLMSE
AVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTTSRSLRGCY
LEELHVLPPGRREPLRSLRILHSARALFVGLSDGVLRVPLERCAAYRSQGACLEARDPYC
GWDGKQQRCSTLEDSSNMSLWTQNITECPVRNVTRDGSFGPWSPWQPCEHLDGDTSGSCL
CRARACDSPRPRCGGRDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSN
PAPRHGGRICVGKSREERFCNENTPCPVPIFWASWGSWSKCSSNCGGGVQSRSRACENGN
SCPGCGMEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLPDPHGLQ
FGRRRVETRTCPADGSGACDTDALVEDLLRSGGTSSHTVSGGWAAWGPWSSCSRDCELGF
RVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGGGHYQR
TRSCTSPAPSPGEDICLGLHTEEALCATQACPEGWSPWSEWSACTEDGVQSRSRHCEELV
PGPSTCAGNSSQSRPCPYSEIPVILPASSVDEATGCGGFSLIHLVTGISCFLGSGLLTLA
VYLSCQHCQHQSQESTLVHPATPNHLHYKGGGTPKNEKYTPMEFKTLNKNNLIPDDRANF
YPLQQTNVYTTTYYPSPLNKHSFRPEASPGQRCFPNS
Download sequence
Identical sequences ENSSSCP00000012644 ENSSSCP00000012644 9823.ENSSSCP00000012644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]