SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012651 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012651
Domain Number 1 Region: 26-532
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.35e-122
Family L-arabinose binding protein-like 0.00000223
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012651
Domain Number - Region: 558-598
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00408
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 605-874
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0796
Family Rhodopsin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012651   Gene: ENSSSCG00000011878   Transcript: ENSSSCT00000012993
Sequence length 1079
Comment pep:known chromosome:Sscrofa10.2:13:147907932:147935070:-1 gene:ENSSSCG00000011878 transcript:ENSSSCT00000012993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSSCCWILLALTWCTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQNLESRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNMTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGISTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQQVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA
SSSLIAMPEYFHVVGGTIGFALKAGQIPGFREFLQKVHPSKSVHNGFAKEFWEETFNCHL
QEGAKGPLTTDTFLRGHEEGGGRISNSSTAFRPLCTGDENISSVETPYMDYTHLRISYNV
YLAVYSIAHALQDIYTCIPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTSNMGEQVTFD
EYGDLAGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACDKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICAIWLYTAPPSSYRNHELEDEIIFITCHEGSLMALGFLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKVYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRQRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKKQQPLALTQHVPQPQAPSTPQPQPQLQQQ
PRCKQKVIFGSGTVTFSLSFDEPQKSATAHRNSTHQNSLEAQKNNDALTRHQALLPLQCG
EADAELTAQETGLQGSVGGDHHPEMEDPEEMSPALVMSNSRSFVISGGGSTVTENMLHS
Download sequence
Identical sequences O62714
ENSSSCP00000012651 9823.ENSSSCP00000012651 XP_005654095.1.46622 XP_020924105.1.46622 XP_020924106.1.46622 ENSSSCP00000012651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]