SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012801 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012801
Domain Number 1 Region: 615-870
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.65e-88
Family Eukaryotic proteases 0.0000000162
Further Details:      
 
Domain Number 2 Region: 197-354
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-37
Family MAM domain 0.0055
Further Details:      
 
Domain Number 3 Region: 375-485
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-27
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 4 Region: 83-187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-17
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 5 Region: 525-627
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000615
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0073
Further Details:      
 
Domain Number 6 Region: 492-530
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 34-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000537
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012801   Gene: ENSSSCG00000012019   Transcript: ENSSSCT00000013150
Sequence length 871
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:192997371:193141213:-1 gene:ENSSSCG00000012019 transcript:ENSSSCT00000013150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISESLENYSTTSPSTTSDKLTTSSPPATPGNVSIECLPGSRPCADALKCIAVDLFCDGEL
NCPDGSDEDSKICATACDGKFLLTESSGSFDAAQYPKLSEASVVCQWIIRVNQGLSIELN
FSYFNTYSMDVLNIYEGVGSSKILRASLWLMNPGTIRIFSNQVTVTFLIESDENDYIGFN
ATYTAFNSTELNNDEKINCNFEDGFCFWIQDLNDDNEWERIQGTTFPPFTGPNFDHTFGN
ASGFYISTPTGPGGRQERVGLLSLPLEPTLEPVCLSFWYYMYGENVYKLSINISNDQNME
KIIFQKEGNYGENWNYGQVTLNETVEFKVAFNAFKNQFLSDIALDDISLTYGICNVSLYP
EPTLVPTSPPELPTDCGGPFELWEPNTTFTSMNFPNNYPNQAFCVWKFNAQKGKNIQLHF
EEFDLENIADVVEIRDGEEDDSLLLAVYTGPGPVEDVFSTTNRMTVLFITNDALTKGGFK
ANFTTGYHLGIPEPCKEDNFQCENGECVLLVNLCDGFSHCKDGSDEAHCVRFLNGTANNS
GLVQFRIQSIWHTACAENWTTQTSDDVCQLLGLGTGNSSMPFFSSGGGPFVKLNTAPNGS
LILTASEQCFEDSLILLQCNYKSCGKKQVAQEVSPKIVGGNDSREGAWPWVVALYYNGQL
LCGASLVSRDWLVSAAHCVYGRNLEPSKWKAILGLHMTSNLTSPQIVTRLIDEIVINPHY
NRRRKDSDIAMMHLEFKVNYTDYIQPICLPEENQVFPPGRICSIAGWGKVIYQGSPADIL
QEADVPLLSNEKCQQQMPEYNITENMMCAGYEEGGIDSCQGDSGGPLMCLENNRWLLAGV
TSFGYQCALPNRPGVYARVPKFTEWIQSFLH
Download sequence
Identical sequences ENSSSCP00000012801 ENSSSCP00000012801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]