SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012808 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012808
Domain Number 1 Region: 233-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.69e-53
Family Reprolysin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 535-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.66e-16
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 833-887
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 883-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012808   Gene: ENSSSCG00000012026   Transcript: ENSSSCT00000013158
Sequence length 945
Comment pep:known chromosome:Sscrofa10.2:13:200127201:200135726:-1 gene:ENSSSCG00000012026 transcript:ENSSSCT00000013158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTARRWGSQSAPTLLLLTAATTLLVLQGAHGRPVEEDEELVLPALERDLAHGTTHLLL
DAFGSQLRLELQPDRGFLAPGFTLQTVGRRPGPNASHSDPAGDLAHCFYSGTVNRDPSSA
AALSLCEGVRGAFYLQGEEYFIQPAPAAAAVSLAPAAAGEEPLARPQFHLLRRRRRGGGG
AKCGVLDDETQLAKDAGSEGEDAAAQWPPQNWEPQRAGQSTGTGSLRKKRFVSSPRYVET
MLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIYEEQKGPEIT
SNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGAQTCDTLGMADVGTVCDPS
RSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNRDSHMMASMLSNLDRSQP
WSPCSAYMITSFLDNGHGECLMDKPQSPIQLPSDLPGTLYDANRQCQFTFGEESKHCPDP
ASTCTTLWCTGTSGGLLVCQTKHFPWADGTSCGEGKWCVNGKCVNKTDKKHFDTPVHGSW
GPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNIEDCPENNGKTFR
EEQCEAHNEFSKASFGSGPAVEWTPKYAGVSPKDRCKLICQAKGIGYFFVLQPKVVDGTP
CSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGICGGNGSTCKKISGSVTSAKPGYHDIV
TIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILNGDFTLSTLEQDITYKGSVLRYS
GSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTYFVKKKKESFNAIPTFSEWVIEE
WGECSKTCGLGVQRRLVECRDINGQPASECAKEVKPASTRPCADLPCPHWQLGDWSPCSK
TCGKGYKKRTLQCLSHDGGVLAHESCDPLKKPKHYIDFCTMAECS
Download sequence
Identical sequences ENSSSCP00000012808 ENSSSCP00000012808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]