SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012809 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012809
Domain Number 1 Region: 264-473
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.14e-54
Family Reprolysin-like 0.00075
Further Details:      
 
Domain Number 2 Region: 566-620
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000017
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 3 Region: 870-923
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000102
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012809   Gene: ENSSSCG00000012027   Transcript: ENSSSCT00000013159
Sequence length 923
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:200405037:200449758:-1 gene:ENSSSCG00000012027 transcript:ENSSSCT00000013159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGWASLLLCALHLPLVAVGPAAAPAQDKAGQPPAAAAASQPRQRQGEEAQEPAEPRGH
PHPLAPQRRSRGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDDSVGAAGFVPAGGGP
SATRRHRGHCFYRGTVDGSPRSLAVFDLCGGLRGFFAVKHARYTLKPLLSWPWSEAESGR
VYGDGSARILHVYTREGFSFEALPPRTSCETPGSPPRPRERPPQHNSPNRRWTLAPQLSD
QAPSSDGSQGPQTWWRRRRRSISRARQVELLLVADASMARMYGRGLQHYLLTLASIANRL
YSHASIENHIRLTVVKVVVLGDKDKTLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYDA
AILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHD
DSKFCEENFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQIL
GPEELPGQTYDASQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTP
CGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPRN
SGRYCTGKRAIYRSCSVTPCPANGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLP
ADVCKLTCRAKGTGYYVVFSPKVTALTRNSRCLCEFCIYTYINHDYLLGSSLECHLCGST
GETCRKFLFVYSFVNKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKKNGEYLIN
GKYMISTSETIIDLNGTVMNYSGWSHRDDFLHGMGYAATKEILIVQILATDPTKALDVRY
SFFVPKKSTPKVNSVTSQGSNKVGSHTAEVQWVTGPWLACSRTCDTGWHTRTVQCQDGNR
KLAKGCLLSQRPSAFKQCLLKKC
Download sequence
Identical sequences ENSSSCP00000012809 ENSSSCP00000012809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]