SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012889 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012889
Domain Number 1 Region: 478-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-50
Family SPRY domain 0.00087
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000103
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 4 Region: 372-483
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000171
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012889
Domain Number - Region: 111-161
Classification Level Classification E-value
Superfamily RING/U-box 0.00104
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012889   Gene: ENSSSCG00000012110   Transcript: ENSSSCT00000013245
Sequence length 667
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:7631914:7759337:-1 gene:ENSSSCG00000012110 transcript:ENSSSCT00000013245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNESVESITAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDGNSMSSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQEAKLMEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCHNTWVVRHNSKEVPIEPAPH
LRRVGILLDYDNGSVAFYDALNSLHLYTFDVTFSQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP
Download sequence
Identical sequences K7GSV3
9823.ENSSSCP00000012889 ENSSSCP00000012889 ENSSSCP00000029279 ENSSSCP00000030659 XP_003134970.1.46622 XP_020936144.1.46622 XP_020936145.1.46622 XP_020936146.1.46622 XP_020936147.1.46622 XP_020936148.1.46622 ENSSSCP00000012889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]