SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012924 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012924
Domain Number 1 Region: 51-296
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.45e-91
Family Carbonic anhydrase 0.0000000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012924   Gene: ENSSSCG00000012141   Transcript: ENSSSCT00000013280
Sequence length 317
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:13188085:13222626:1 gene:ENSSSCG00000012141 transcript:ENSSSCT00000013280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMLSRLRVILQASPCRALWRRFQIPRSMSARPCSLYTCTYKTRNRDLHPLWESADLVPA
GERQSPINIRWRDSVYDPGLKPLTISYDPTTCLHVWNNGYSFLVEFEDSTDKSVIEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFENFEDAAQEENGLAVI
GVFLKLGKHHKEVQKLVDTLPSIKHKDTLVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPIEVAHDQLEQFRTLLFTSKGETEKRMVDNFRPLQPLMNRTVRSSFHHDY
VLNMQAKPKPSTSQVTS
Download sequence
Identical sequences F1SQS9
ENSSSCP00000012924 9823.ENSSSCP00000012923 XP_005673507.1.46622 XP_020935797.1.46622 ENSSSCP00000012924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]