SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013037 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013037
Domain Number 1 Region: 810-848,901-1218
Classification Level Classification E-value
Superfamily Cysteine proteinases 1e-88
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000557
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013037
Domain Number - Region: 142-224
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.031
Family Ubiquitin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013037   Gene: ENSSSCG00000012251   Transcript: ENSSSCT00000013397
Sequence length 1812
Comment pep:novel chromosome:Sscrofa10.2:X:41007301:41060997:1 gene:ENSSSCG00000012251 transcript:ENSSSCT00000013397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQSNDDIASRAIDLLKEIYTNLGP
RLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSINCARQEAVRMVRVLTVLREYIN
ECDSDYHEERTILPMSRAFRGKHLSFIVRFPNQGRQVDDLDVWSHTNDTIGSVRRCILNR
IKANVAHTKIELFVGGELIDPADDRKLIGQLNLKDKSLITAKLTQVSSNMPSSPDSSSDS
STGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISFLWQVADLGSSLNMPPLRDGARV
LMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLFFGPSASQVLYLTEVVYALLMPA
GAPLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNADMETRRGAYLNALKIAKLLLTAI
GYGHVRAVAEACQPGVEGVNPMASVNQVTHDQAVVLQSALQSIPNPSSECMLRNVSIRLA
QQISDEASRYMPDICVIRAIQKIIWASGCGALQLVFSPNEEITKIYEKTNAGHEPDLEDE
QVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSKTVRQVAQEQFFLMCTR
CCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLRHLLNYAYNSNINIPNAEVLLNN
EIDWLKRIRDDVKRTGETGVEETILEGHLGVTKELLAFQTPEKKYHIGCEKGGANLIKEL
IDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPSTINAGFELLVALAVGCVRNLKQIVDS
LTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIR
NGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGYPQQFEDKPALSKTEDRKEYNIG
VLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNLREQHDALEFFNSLVDSLDEALK
ALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNHQNLLDSLEQYVKGDL
LEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPREL
DMEPYTVAGVAKLEGDNVNQESQLIKQNEQSDSETAGSTKYRLVGVLVHSGQASGGHYYS
YIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYRRQ
KRWWNAYILFYERLDTIDQGDELIKYISELAITTRPHQIIMPSAIERSVRKQNVQFMHNR
MQYSLEYFQFMKKLLTCNGVYLNPPPGQDHLLPEAEEITMISIQLAARFLFTTGFHTKKI
VRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECPSAEVRGAFAKLIVF
IAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAVLNLLRREVSEHGRHLQQYFNLF
VMYANLGVAEKTQLLKLNVPATFMLVSLDEGPGPPIKYQYAELGKLYSVVSQLIRCCNVS
SRMQSSINGNPPLPNPFGDPNLSQPIMPIQQNVADILFVRTSYVKKIIEDCSNSEETVKL
LRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLLQILLIEDSWQTHRIHNALKGI
PDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPVAYQILQGNGDLKRKWTWAVEWL
GDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERSHSARMTLAKACELCPEEEPDDQ
DAPDEHESPPPEDAPLYPHSPGSQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEG
SEEVSPPQTKDQ
Download sequence
Identical sequences ENSSSCP00000013037 ENSSSCP00000013037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]