SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013061 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013061
Domain Number 1 Region: 258-446,737-887
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.31e-110
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000072
Further Details:      
 
Domain Number 2 Region: 27-139
Classification Level Classification E-value
Superfamily DUSP-like 5.1e-29
Family DUSP, domain in ubiquitin-specific proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013061   Gene: ENSSSCG00000012273   Transcript: ENSSSCT00000013421
Sequence length 921
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:46746252:46760931:-1 gene:ENSSSCG00000012273 transcript:ENSSSCT00000013421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSGGRTAMAAVAASPAAAAEDQELQREAVPGLESQRRQIENGENGRGRPLQAGESWFLVE
QHWYQKWEEYVQGGDQDSSTSPGCINNAGLFEDQVNWRLKKGLVEGEDYVLLPAAAWHYL
VNWYGLEHGQPPVERKVVELPGIQKVEVYPVELLLVQHSDMDTAHTAQFSHTDSLDLVLH
TAREQFLVSPQEETRLWIKNAEGSFERLCNTHVTVLDAALKTGQVVIMETRNKDGTWPSA
QPHAMNSATEEEEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLKNRYLEELN
FCNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKTKVGHFASQFLGYQQHDSQELLSF
LLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLV
CPDCGNVSVTFDPFCYLSVPLPVSHKRVMEVFFVSMDPRRKPEQHRLVVPKKGKISDLCV
ALAKHTGVSPERMMVADVFSHRFYKIYQLEESLSSILDRDDIFIYEVSGRAAIGENSRED
VVLPIYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRLSWDALYHILLYRLSRYVTRPS
SDDEDDGDEKDLEDKDTLPKPGHVAGSSSQDPGLEQAGPSSGVAGGSRAPVDNSPGPSHW
PQRARRKHLFTLQTVNSNGTSDRSTFNEDTHGVSFSSQPYIAIDWEPEMKKRYYDEVEAE
GYVKHDCVGYVLKKAPVRLQECIELFTTVETLEKENPWYCPTCKQHQLATKKLDLWMLPE
TLIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFVIKPQNESAPELYKYDLIAVSNHYG
GLRDGHYTTFACNKDSGQWHYFDDNSVSPVTENQIESKAAYVLFYQRQDVARRLQPQPGF
SERPASPACGIPPSSEFMDVN
Download sequence
Identical sequences ENSSSCP00000013061 ENSSSCP00000013061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]