SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013067 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013067
Domain Number 1 Region: 255-306
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000288
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 2 Region: 133-182
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000484
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 3 Region: 185-246
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.00079
Further Details:      
 
Domain Number 4 Region: 75-113
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 309-369
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000116
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 6 Region: 380-413
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000275
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013067   Gene: ENSSSCG00000012278   Transcript: ENSSSCT00000013427
Sequence length 463
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:47326119:47335184:1 gene:ENSSSCG00000012278 transcript:ENSSSCT00000013427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTQRQAPQLLLLPLLLLTLPATGSDPVLCFTQYEESSGKCKGLLGGGVSLEDCCLNADY
AFQETSSKFCMPCRPPQWSPWSAWAPCSVTCTEGSQLRHRRCVGWGGQCPENVELGTLQW
QLQVALFPPTEMGGWSSWGPWAPCSATCSRGTRTRRRACDRPTPKCGGHCPGEAQESEDC
DTQQVCPTHGAWAAWGPWGPCQSTCKGGPSEPVERRKRTCTAPEPSTKPPGNPCSGSAND
QRMCSGLPPCPATVAGGWGPWGAVSPCPVTCGLGQTREQRSCDHPVPQHGGPFCVGEAFR
THICNTAVPCPVDGEWGLWGEWSNCVRRGIKHISCQEIPGQQTRSRICKGRKFDGRRCLG
EQQDIRHCYSIQRCPLKEASWSEWSTWGLCIPPCGPSPVRTRQRLCQPKLPNFPPTITPV
EGQGEKNVTFWGKPLVKCDVLQGQHMMVEEKRPCLHAPPCNEP
Download sequence
Identical sequences ENSSSCP00000013067 ENSSSCP00000013067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]