SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013095 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013095
Domain Number 1 Region: 173-517
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.08e-96
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000796
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000141
Family Zf-UBP 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013095   Gene: ENSSSCG00000012305   Transcript: ENSSSCT00000013455
Sequence length 523
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:48463153:48464721:-1 gene:ENSSSCG00000012305 transcript:ENSSSCT00000013455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGPPGCSHVNSFKVGENWRQELRVIYQCFVWCGTPETRKSKAKSCICHVCGTHLNRLHSC
LSCVFFGCFTEKHIHEHAETKQHNLAVDLYYGGIYCFMCKDYVYDKDIEQIAKEEQGEAL
KLQASTSTEVSHQQCSMPGLGEKYPTWETTKPELELLGHNPRRRRITSSFTIGLRGLINL
GNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSPHVP
YKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDAGKAANNPNHCNCIIDQIF
TGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSVNGESHIPGITTL
TDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMNKLPVVACFHFKRFEHSAKQRRKI
TTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNDENKYSLFAVVNHQGTLESGHYTS
FIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHKQVLEHE
Download sequence
Identical sequences ENSSSCP00000013095 ENSSSCP00000013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]