SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013143 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013143
Domain Number 1 Region: 360-704
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-94
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000998
Further Details:      
 
Domain Number 2 Region: 192-298
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-16
Family Zf-UBP 0.014
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013143
Domain Number - Region: 204-227
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000418
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013143   Gene: ENSSSCG00000012349   Transcript: ENSSSCT00000013504
Sequence length 710
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:54047809:54049941:1 gene:ENSSSCG00000012349 transcript:ENSSSCT00000013504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQVREASLPLGSLVRCSSGDGRGASPEEGAEKAGEMEEEELGAAKAYSGPGAVEMKLEP
SQEHKPAPEENFTWSGSCSDEKVLPSNPLRCYSSSLTLCPRRKPRPRPQPGTHFLGPPRS
WAPPPPPSRPPPPPPPRPRPSPRPWRRSQRRSGPRYRPQTPRSCSSDLGGSGDPDSLGDW
LLEVEFDQQGPTGCSHVESFKVAKNWQKNLRLIYQRFIWSGTPETRKRKAKSCICHVCST
HMNRLHSCLSCVFFGCFTEKHIHKHAETKQHNLAVDVYHGVIYCFICKDYVYDKDIEQIA
KETKDKVSKLLTSTSSDVSQQQCMTSGVEEKQLTCESKEQEPKLVKPKKKRRKKSVYTVG
LRGLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYSG
NRTPHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKEDSVGQEASNPNCCN
CIIDHIFTGGLQSDVTCQVCHTVSTTIDPCWDISLDLPGSCATFSCQNPERADGTVSRDE
RIPGNPSLTDCLQWFTRREHLGSSAKIKCSSCQSYQESTKQLTMKKLPIVACFHIKRFEH
VGKQRRKINTFISFPLELDMTPFLSSTKESKMKERQPQTDYAPIENKYSLFAVINHHGTL
ESGHYTSFIRQQKDQWFSCDDAVITKATIEDLLYSEGYLLFYHKQGLEKD
Download sequence
Identical sequences F1RTR5
9823.ENSSSCP00000013143 ENSSSCP00000013143 ENSSSCP00000013143 XP_003135158.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]