SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013179 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013179
Domain Number 1 Region: 124-276
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.61e-35
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013179   Gene: ENSSSCG00000012383   Transcript: ENSSSCT00000013541
Sequence length 289
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:63332324:63333382:1 gene:ENSSSCG00000012383 transcript:ENSSSCT00000013541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSQSEHQRMIRRHNREKKELQARIQSMKNSVPRSDKKRRKQMLLDVARLEAEMEQKHQ
QELEKFQESFPGNLDSVTEDLAKMDLENQPPRPSRAQRRRERRAALARERQERIAEAEME
HLASFRKDEEEKLRAILGAKNLEMKDIPADGHCMYRAIQDQLVFSVTVESLRRRTAEYMQ
KHVDDFLPFFSDPETGDSYSRDDFLSYCDDIVRSASWGGQLELRALSHILQTPIEVIQAN
SPAVVIGEEYTKRPLILVYMRYACSLGEHYNSVKPLEAGAVGGAPPRLF
Download sequence
Identical sequences F1RTK5
ENSSSCP00000013179 XP_003135205.2.46622 9823.ENSSSCP00000013179 ENSSSCP00000013179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]