SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013361 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013361
Domain Number 1 Region: 496-674
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-44
Family SPRY domain 0.0026
Further Details:      
 
Domain Number 2 Region: 183-248
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 19-106
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000106
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 4 Region: 393-501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000184
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013361
Domain Number - Region: 124-179
Classification Level Classification E-value
Superfamily RING/U-box 0.00353
Family ZZ domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013361   Gene: ENSSSCG00000012564   Transcript: ENSSSCT00000013739
Sequence length 703
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:102730635:102831134:1 gene:ENSSSCG00000012564 transcript:ENSSSCT00000013739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESPASAVLNASAGLFSLKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSC
SSGESIEPITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRR
ERTYRPSSAMSSERIACQFCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLV
EPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQT
LEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMIAV
KIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMA
TASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVH
WISDDEFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFI
VKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERF
SGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGKNASSWVFSRCNS
NFVVRHNNKEMLVDVHPQLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFT
IWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences ENSSSCP00000013361 ENSSSCP00000013361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]