SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013384 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013384
Domain Number 1 Region: 7-345
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-101
Family Calpain large subunit, catalytic domain (domain II) 0.000000316
Further Details:      
 
Domain Number 2 Region: 356-497
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.7e-33
Family Calpain large subunit, middle domain (domain III) 0.00034
Further Details:      
 
Domain Number 3 Region: 519-631
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.13e-16
Family PLC-like (P variant) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013384   Gene: ENSSSCG00000012584   Transcript: ENSSSCT00000013762
Sequence length 641
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:105673315:105702685:-1 gene:ENSSSCG00000012584 transcript:ENSSSCT00000013762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPLKLFKNQKYQELKQECIRDGRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDD
PRLIVGNISNHQLIQGRLGHKPMVSAFSCLAVQESHWTKTIPNHKEQEWDPRKLDKYAGI
FHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGL
TTTDIIVDFTGTLAETVDMQKGRYTELVEEKYKLFGELYKTFTKGGLICCSIESPNQEEQ
EVETDWGLLKGHTYTMTDIRKIRLGERLVEVFSTEKLYMVRLRNPLGRQEWSGPWSEISE
EWQQLTAADRKNLGLVMSDDGEFWMSLEDFCRNFHELSVCRNVNNPIFGRKELESVVGCW
TVDDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPDNYI
IGFELFKVEMNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTS
EFLLRIFSEVPVQLRELTLDMPKMSCWNLARGYPKVVTQITVHSAEGLEKKYANETVNPY
LVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNRRKFCDQFLGQVTLDA
DPSDCRDLKSLYLRKKGGPTAKVKQGHISFKVISSDDLTEL
Download sequence
Identical sequences F1RWU4
ENSSSCP00000013384 XP_003135366.1.46622 XP_020935754.1.46622 ENSSSCP00000013384 9823.ENSSSCP00000013384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]