SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013387 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013387
Domain Number 1 Region: 213-341
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.55e-20
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.024
Further Details:      
 
Domain Number 2 Region: 483-537
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000203
Family Tudor domain 0.019
Further Details:      
 
Domain Number 3 Region: 52-123
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000000471
Family Gtf glycosyltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013387   Gene: ENSSSCG00000012586   Transcript: ENSSSCT00000013765
Sequence length 1122
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:106059484:106122895:1 gene:ENSSSCG00000012586 transcript:ENSSSCT00000013765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCVFVTVGTTSFDDLIACVSAHDSLQIIKSLGYNRLVLQIGRGKVVPEPFSTESFTLDV
YRYKDSLKEDLQKADLVISHAGAGSCLETLEKRKPLVVVINEKLMNNHQLELAKQLHKDG
HLFYCTCRVPTCPGQASPLLLLLRSAKILQRLDFGLLSGYLHKQALVTATHSYLHPAFSF
LPHLCSFLPFPCTMHKGWKKYCGQRSLNEASMDEYLGSLGLFRKLTAKDASCLFRAISEQ
LFCSQVHHLEIRKACVSYMRENQQTFESYVEGSFEKYLERLGDPKESAGQLEIRALSLIY
NRDFILYRYPGKPPTYVTDNGYEDKILLCYSSNGHYDSVYSKQFQSSAAVCQAVLYEILY
KDVFVVDEEELKTAVELFRSGSKKNRNNAVTGSEDVHIDYKSSTQDRTEEWGACCNVENI
PEGYNQGTEEAKSSENPSKMLFPYKVLKALDPEIYRNVEFDVWLDSRKVELQKSDYMEYA
GRQYYLGDKCQVRLESGGRYYNAHIQEVGNENNSVTVFIEELAEKHVVPLANLKPVTQVT
PVPAWNALPSRKGRGYQKFSGGYVPEMAMSEMDMKQRKKMFKKVRGKEVYMTMAYSRGEP
LLPPRLQHSMHYGHDPPMHYSQTADNVMSNEHFHPQHSSQRQGRGYGMPRDSSRFINRHN
MAGPKVAFYPGPGKRCCQSYDNFSYRSRSFRRSHRQMHCMNKECQYSFAPENGQMPRGLE
ETITFYEVEEGDETAYPSLPNHGGPSTMVPATSRYCVARRGHSSGKQTLNSEEGDGRSDN
GGYHEEYIYPSEPDYETSGVYSTTESTANLSLQDRRPCSMSPQDPITSYSYPQKVMVNSA
AIAASCANNVPAPVLSNCAAANQASSTTSISSQNAIQPLFVSPPTQGRPVFMISALKMIA
SPSYPYLSAPVPAAAASLPPPPPPPPPPPPPPPPLEVGEASNLPPPPPPYSCDPSGSDLP
QDTKVLQYYFNLGLQCYHHSYWHSMVYVPQMQQQQLHVENYPVYTEPHPLVDQTIPPLYS
EVGRQDGTQAEVSANCPFPNADPASVPHGAVYYPVMSDPYGQPPLPGFDSCLPVVPDYPY
VAPWHPVGAAYGGSPQIHGAMTPGPLGYVASSPSASHYVPQN
Download sequence
Identical sequences ENSSSCP00000013387 ENSSSCP00000013387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]