SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013477 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013477
Domain Number 1 Region: 291-398,431-564,808-876
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-72
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013477   Gene: ENSSSCG00000012678   Transcript: ENSSSCT00000013860
Sequence length 904
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:125126919:125129732:-1 gene:ENSSSCG00000012678 transcript:ENSSSCT00000013860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVAHGFVQIWSRKTGMSKSKEAFIQTVERKSKVRLVVYFRTGEHTTFRLSNNIKSVV
LRSYGKKQNHVHLTFQDNSFLFIEKLSSRDAENLKAFLDRVHENNLQPPIRPDRDGSVFA
STAVRKPVNKTSFHKTCKKSGSPSFEKGGKNETPDLEKMPLFASKSSTLTWEELLENGYG
KRKKMLSSGSEMNRNFLKENIFVRKKRSKTNPFRHASHKERKESRLKQNKKLEFGPSFKI
SSTGKPYLDGVGLLQMLTKNIYLAFLSESKYGEDDPDWDKLKMTLDFYPEKLWQGFPNLG
NTCYMNAVLQSLFSIPSFADDLLSQGFPWGKIPLDALNMCLAQLLVLKDIYNIKIKERLL
VNIKKAISAVAEIFSDNIQNDAHEFLGQCLDQMKENMGQLNSIWETTFESEQGDSPQQVL
TGSTATEMLVCPVITNFEFELLCSIVCKACGQVVLKTEVSNYLSINLPQGTEALPLSIQS
SFDHFFGAEELEYQCEKCKHRGSVAVHKFGRLPRVLIVHLKRYSFNEFWSLKKDDQEVII
SKYLKLSSHCSESTKPPLPLSKNAHIREFQILKIFQRINSEIFGLSTPSAEPTSESKDSL
AAHIGSEKEAESQKYQILDKGLSGEQQKDLGKSTPNVMDSTLLNSGDGAAIARELLAVSL
MMDLEDNFLSPKGKPTSSTCQEVPENPKLKKCKRSNMFVDLEGVTETIKHVCKDKPSRIS
EVFHQESEQAQQYERLRLYEQALWLALLQSLPKPGARYTKNPRRPTEVHFQGADVNSLGA
LGSDKNPGNKKCLDRKTEPETKKPKRNAEMEDPHAYRLIGVVSHLGKTPNSGHYISDAYD
FERQVWFTYNDLQVSSIQEAPMQEARLCTGYIFFYMHNEIFEELLEREENSQPHSTEAGK
TPRE
Download sequence
Identical sequences F1RTE2
ENSSSCP00000013477 XP_020936242.1.46622 9823.ENSSSCP00000013477 ENSSSCP00000013477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]