SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013645 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013645
Domain Number 1 Region: 257-314
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000425
Family ATI-like 0.039
Further Details:      
 
Domain Number 2 Region: 616-676
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000311
Family ATI-like 0.036
Further Details:      
 
Domain Number 3 Region: 768-817
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000795
Family Fibronectin type I module 0.036
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013645
Domain Number - Region: 748-778
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000523
Family ATI-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013645   Gene: ENSSSCG00000012835   Transcript: ENSSSCT00000014030
Sequence length 1099
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:39271:45415:1 gene:ENSSSCG00000012835 transcript:ENSSSCT00000014030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSTWGAGHFSTFDGHVYDFSGTCNYIFAATCEDASSTFSVQLRRGPSGNISRVIVELGAS
VVTVQQGVISVKDEGVVSLPYTSHGLQMTPFGQSVRLVAKRLELELVVVWGPGAYLMVLV
EKKNVGRMCGLCGNFNGQRTDEFLSEDGKLLDPHKYAALQKLDDPNEICSYEAIPSPRGL
QAGHAQTCSRLLTLVAPMCNVSKEPFLLSCQADMAACAQPGWYNCSCATLSEYSRQCSMA
GQPVRPWRGPGLCSVGECPANQVYRECGEPCVRTCSNPQPSCSGFCTFGCFCPEGTVLDD
SSKNHSCVPVPQCPCTRGGEVYAPGEATTAACQTCRCSGGRWECVEQPCPHRCALEGGSF
VTTFDARPYRFHGTCTYTLLQSPQLPDGGALLAVYDKSGYSHSETSLAAVIYMSSQDKIV
ISRDEVITNNGDTKRLPYHTRNITVFRQTSTLIQMVSTFGLELEVQLSSVFQVYVTVGPQ
FRGQTRGLCGTFNGDTTDDFTTSMGIAEGTASLFVDSWRAGNCPAALERETDPCSMSHLN
KVCAETHCAVLVKTGTVFEQCHATVDPKPFYKRCVYQACNYEETFPHICAALGSYALACA
SRGVLLQGWRSSVDNCTISCTGNQTFSYNSQACDRTCLSLSDQVQCHPSAVPVDGCNCPE
TYLNHKAECVRKAQCPCLLDDNKFLLAGQSTAVNGVICHCINGRLSCPARPLMLLEAQGR
AGTGRGLGGKGQGQEQAGPPPGPTLLLQVPTKCEPGCACPGLYENASGQCVPPEECPCEY
GGVSYPRGAELHADCKSCVCSRGTWTCQQSTRCPSTCTLYGEGHVVTFDGQRFVFDGSCE
YILVTDGCGASDAQPTFKILTENVVCGNSGVTCSRAIKILSGDLSIVLADGNYTVSGEDP
GVRFRVKAGSLHLELDATIGSAYNLSLIWNKHMTVFIKVAGASQDTLCGLCGNYNGNMKD
DFQTRSRYVASSELEFVNSWKESPLCGDTTFTLDPCSLNTFRQSWAERKCSIINSQTFAA
CHSQVYHLPYYEACVRDTCGCDTGGDCECLCDAVAAYAKACVDKGVCIDWRSPDFCPIYC
DFYNTHAQEVNCTWHYQPC
Download sequence
Identical sequences ENSSSCP00000013645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]