SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013700 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013700
Domain Number 1 Region: 118-373
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-55
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 420-679
Classification Level Classification E-value
Superfamily YWTD domain 4.58e-40
Family YWTD domain 0.0000719
Further Details:      
 
Domain Number 3 Region: 808-846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 770-805
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 730-768
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 6 Region: 75-113,367-416
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000033
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 687-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000591
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013700
Domain Number - Region: 2-47
Classification Level Classification E-value
Superfamily YWTD domain 0.000327
Family YWTD domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013700   Gene: ENSSSCG00000012885   Transcript: ENSSSCT00000014086
Sequence length 1088
Comment pep:known chromosome:Sscrofa10.2:2:3168524:3213765:-1 gene:ENSSSCG00000012885 transcript:ENSSSCT00000014086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVINIDGTERRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPD
LMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFL
VFTSRAAIHRISLDTNNNDVAIPLAGVKEASALDFDVSTNHIYWTDVSLKTISRAFMNGS
SVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLA
LDPTKGYIYWTEWGGKPRIVRAFMDGTNGMTLVDKVGRANDLTIDYADQRLYWTDLDTNM
IESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLD
FVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPSGHRCSCASHYTLDPSSRNCSPPTTF
LLFSQKCAVSRMIPDDQHSPDLILPLHGLRNVRAIDYDPLDKFIYWVDGRQNIKRAKDDG
TQPFVLTSPGQSQSPDRQPHDLSIDVYGRTLFWTCEATNTINVHRLNGDAMGVVLRGDRD
KPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLF
WVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVDKTTGDS
RTRVQGRVAHLTGIHAVEDISVEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLL
QNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCAR
GQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDE
LMCEITKLPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGATGPFPHEYV
SGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRAGVPLYDRNHVTGASSSSSS
STKATLYPPILNPPPSPATDPSLYNLDVFYSSNIPAAARPYRPYIIRGMAPPTTPCSTDV
CDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPP
PSPCTDSS
Download sequence
Identical sequences ENSSSCP00000013700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]