SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013708 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013708
Domain Number 1 Region: 8-406
Classification Level Classification E-value
Superfamily ALDH-like 7.07e-116
Family ALDH-like 0.00000000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013708   Gene: ENSSSCG00000028501   Transcript: ENSSSCT00000014094
Sequence length 410
Comment pep:novel chromosome:Sscrofa10.2:2:3518994:3536523:1 gene:ENSSSCG00000028501 transcript:ENSSSCT00000014094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFADTLQRLRETFSSGRTRPAEFRATQLKGLGRFLQENKQLLQEALAQDLHKSTFESQ
VSEISISQSEINLALRNLRAWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIAPWNYPVNL
TLMPLVGALAAGNCVVLKPSEISKSTEKVLAEVLPRYLDQSCFAVVLGGPEETGQLLEHK
FDHIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNT
GQTCVAPDYILCSPETQARLLPALQSAITRFYGDDPRASPDLGRIINHKHFQRLRGLLSC
GRVAIGGQSDDSDRYIAPTVLVDVQETEPVMQEEIFGPILPILNVRGLDEAIDFINRREK
PLALYAFSNNSQVVKRVLAQTSSGGFCGNDGFMHMTLSSLPFGGVGRCLL
Download sequence
Identical sequences A0A0K1TQQ2
ENSSSCP00000013708 NP_001302522.1.46622 ENSSSCP00000013708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]