SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013715 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013715
Domain Number 1 Region: 43-471
Classification Level Classification E-value
Superfamily ALDH-like 8.64e-120
Family ALDH-like 0.000000000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013715   Gene: ENSSSCG00000026349   Transcript: ENSSSCT00000014101
Sequence length 502
Comment pep:novel chromosome:Sscrofa10.2:2:3563353:3568662:1 gene:ENSSSCG00000026349 transcript:ENSSSCT00000014101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQKRSLAPAMWGRGLGGTTPRPGCGRAQLGSPSSPRMDPFADTLQRLREAFSSGRTRPVE
FRATQLKGLGRFLQENKQLLQEALAQDLRKSAFEGDMCEILLCQNEVDLALKNLHTWTKD
KPVAKNLFTQLDSAFIRKEPFGLVLIIAPWNYPVNLTLMPLVGALAAGNCVVLKPSEISK
STEKVLAEVLPRYLDQSCFAVVLGGPEETGQLLEHKFDYIFFTGEGGSGQIVMTAAAKHL
TPVTLELGGKNPCYVDDNCDPQTVANRVALFRYLNTGQTCVAPDYILCSPETQARLLPAL
QSAITRFYGDDPRASPDLGRIINHKHFQRLQGLLSCGRVAIGGQSDDSDRYIAPTVLVDV
QETEPVMQEEIFGPILPILNVRGLDEAIDFINRREKPLALYAFSNNSQVINQMLDRTSSG
TFGGNDGFIYLTLPSLPLGGVGNSGMGRYHGEFSFDTFSHHRACLLAHSDLEKLNEIRYP
PYSGWNQQVISWAMGNQRCSIL
Download sequence
Identical sequences ENSSSCP00000013715 ENSSSCP00000013715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]