SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013761 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013761
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000072
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0057
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000733
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013761
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013761   Gene: ENSSSCG00000012942   Transcript: ENSSSCT00000014147
Sequence length 802
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:5067608:5072359:-1 gene:ENSSSCG00000012942 transcript:ENSSSCT00000014147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGSTGLLSAQELEEIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLSLPSSLDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLETRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYL
GFERSELLCKSWYGLLHPEDLGHASAQHYRLLAESGDIQAEMVVRLLAKPGGWAWIYCLL
YSEGPEGPITANNYPISDSEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENILSQEQCSS
PNPLFTMGPPRSTDFPRAPEPSAVSTSEELLRPTKDLGFGYLTFPSGPEPSLQADLSKDF
VCTPPYTPHQPGGCAFLFSLHEPFQPHLPIPPSSLQEQLTPSTATFSDQLTPSSATFPDP
LTSPLQGQLTETSARSYEDQLTPCTSTFPDQLLPSTATFPEPLGSPAREQSTPPSTAFQA
HLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLE
SLGGLEPLDSNLSLSGAGPPVLSLELKPWKCQDLDFLADPDNIFLEETSVEDIFMDLSTP
DPNGEWSSGDPEAAVPGGAPSPCNNLSPEDRSFLEDLATYETAFETGVSAFPYDGFTDEL
HQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences 9823.ENSSSCP00000013761 ENSSSCP00000013761 ENSSSCP00000013761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]