SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013762 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013762
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.46e-24
Family Ribosomal L11/L12e N-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.34e-18
Family Ribosomal protein L11, C-terminal domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013762   Gene: ENSSSCG00000012943   Transcript: ENSSSCT00000014148
Sequence length 192
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:5054876:5057918:1 gene:ENSSSCG00000012943 transcript:ENSSSCT00000014148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRATRALKKPEASGMIRAIVRAGQARPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARHTGKEVAGLVTLKHVYEI
ARVKAQDDAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERALFLAAQRE
ADLAAQAEAAKK
Download sequence
Identical sequences F1RU54
ENSSSCP00000013762 4v19_K 5aj4_BK 6gaw_BK 6gb2_BK XP_003122536.1.46622 9823.ENSSSCP00000013762 ENSSSCP00000013762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]