SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013791 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013791
Domain Number 1 Region: 39-352
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.53e-87
Family Papain-like 0.00000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013791   Gene: ENSSSCG00000012970   Transcript: ENSSSCT00000014177
Sequence length 367
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:5550132:5554197:-1 gene:ENSSSCG00000012970 transcript:ENSSSCT00000014177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTAHLSCLLVLVVAGPAQGLKDALRSQDPGPQPMGLKEVFTLFQIQYNRSYSNPAEHA
RRLDIFAQNLAKAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLHGHHWGAGKAPSMGIKVG
SEESGETVPQSCDWRKKPGVISAIKHQKDCNCCWAMAAVDNVEAQWAIKYHQAVQLSVQQ
VLDCDRCGNGCNGGFVWDAFLTVLNTSGLASEQDYPYKGTVKTHRCLAKQHRKVAWIQDF
LMLQFCEQSIARYLATEGPITVTINAGLLQQYKRGVIRATPATCDPHLVNHSVLLVGFGK
SKSVEGRRPRPGHSIPYWILKNSWGPDWGEEGYFRLHRGSNTCGITKYPVTARVDKPVKK
HQISCPP
Download sequence
Identical sequences F1RU23
ENSSSCP00000013791 9823.ENSSSCP00000013791 ENSSSCP00000013791 XP_003122571.3.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]