SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013809 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013809
Domain Number 1 Region: 852-921
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.46e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 343-405
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-18
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 3 Region: 730-851
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 912-1064
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000439
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 1074-1125
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000209
Family TB module/8-cys domain 0.0024
Further Details:      
 
Domain Number 6 Region: 609-730
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 216-293
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000445
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 8 Region: 515-643
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000455
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 291-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000281
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 10 Region: 1162-1203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000054
Family EGF-type module 0.007
Further Details:      
 
Domain Number 11 Region: 1189-1239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 57-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000289
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013809   Gene: ENSSSCG00000012985   Transcript: ENSSSCT00000014195
Sequence length 1244
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:5840778:5861803:-1 gene:ENSSSCG00000012985 transcript:ENSSSCT00000014195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LARERFKVVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLP
CMNGGQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLGRAGSLSTGALPPLAPDG
ESVASKHAIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPP
ASVQVHRIEGPNAEGPAPSQHLLPHPKPQHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGL
TKQEDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDIN
ECAMPGMCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQH
PLTTRLTRQLCCCSVGKAWGARCQRCPADGTAAFKEICPAGKGYHILTSHQTLTIQGESD
FSLFLHPDGPPKPQQLPESPSRAPPPEDTEEERGVSTDSPVVEEHSAQQSHPTVTTSPAR
PYPELISRPSPPRFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPSDYSCH
CNPGYRSHPQHRYCVDVNECEAEPCGAGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVD
LNECSKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDSKCEN
KPGSFKCIACPPGYRSQGGGACRADVNECAEGNPCSPGWCENLPGSFRCTCAQGYAPSPD
GRSCLDVDECEAGDVCDNGICNNTPGSFQCQCLSGYHLSRDRSRCEDIDECDFPAACIGG
DCINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPGLCLPHGACENLQGSYVCICDEGFT
PTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPC
PVYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECILFGAEICKEGKCVNTQPGYEC
YCKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPE
EMDVDECQDPTACRHGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPADRAPERRDVCW
SQRGEDGMCAVPVSGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSQCPTSQSESNSFWDT
SPLLLGKPPREEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECR
ELNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
Download sequence
Identical sequences ENSSSCP00000013809 ENSSSCP00000013809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]