SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013824 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013824
Domain Number 1 Region: 21-360
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.25e-139
Family Calpain large subunit, catalytic domain (domain II) 0.0000000000157
Further Details:      
 
Domain Number 2 Region: 366-526
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.84e-56
Family Calpain large subunit, middle domain (domain III) 0.0000000563
Further Details:      
 
Domain Number 3 Region: 528-712
Classification Level Classification E-value
Superfamily EF-hand 5.71e-47
Family Penta-EF-hand proteins 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013824   Gene: ENSSSCG00000012999   Transcript: ENSSSCT00000014210
Sequence length 714
Comment pep:known chromosome:Sscrofa10.2:2:6129549:6155373:-1 gene:ENSSSCG00000012999 transcript:ENSSSCT00000014210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVITPVYCTGVSAQVQKLRAKELGLGRHENAIKYLGQDYEQLRAHCLQSGSLFRDEA
FPPVPQSLGFKELGPNSSKTYGVKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYSIILK
ALERGSLLGCSIDISSVLDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYQRDQLRVRMEDGEFWMSFRDFLREFTRLEICNLTPDALKS
QRVRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPEDDYGGRESGCSF
VLALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKKAGTQELDDQVQAILPDEQVLSE
EEIDENFKALFRQLAGEDMEISVRELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLFELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Download sequence
Identical sequences P35750
ENSSSCP00000013824 NP_001335713.1.46622 XP_005660759.1.46622 ENSSSCP00000013824 9823.ENSSSCP00000013823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]