SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013851 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013851
Domain Number 1 Region: 883-1063
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-38
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 473-677
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 689-879
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-34
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 286-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.52e-33
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 5 Region: 25-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-29
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 1096-1236,1265-1307
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-29
Family Laminin G-like module 0.000000908
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000013851
Domain Number - Region: 208-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000329
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013851   Gene: ENSSSCG00000013024   Transcript: ENSSSCT00000014237
Sequence length 1696
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:6587432:6684684:1 gene:ENSSSCG00000013024 transcript:ENSSSCT00000014237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSPWRPPSLPLLLLLTLAAGAGGLEFGGGPGQWARYARWAGAASSGELSFSLRTNAT
RALLLYLDDGGDCDFLELLLVDGRLRLRFTLSCAEPATLQLDTPVADDRWHMVLLTRDAR
RTALAVDGEARAAEVRSKRREMQVASDLFVGGIPPDVRLSALTLSTVKYEPPFRGLLANL
KLGERPPALLGSQGLRGAAADPLCAPARNPCANGGLCTVLAPGEVGCDCSHTGFGGKFCS
EEEHPMEGPAHLTLNSEVGSLLFSEGGAGRGGAGDVHQPTKGKEEFVATFKGNEFFCYDL
SHNPIQSSTDEITLAFRTLQRNGLMLHTGKSADYVNLSLKSGAVWLVINLGSGAFEALVE
PVNGKFNDNAWHDVRVTRNLRQHAGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYI
GGSPNTADLPGSPVSNNFMGCLKDVVYKNNDFKLELSRLAKEGDPKMKLQGDLSFRCEDV
AALDPVTFESPEAFVALPRWSAKRTGSISLDFRTTEPNGLLLFSQGRRAGAGASSHSTAQ
RADYFAMELLDGYLYLLLDMGSGGIKLRASSRKVNDGEWCHVDFQRDGRKGSISVNSRST
PFLATGESEILDLESELYLGGLPEGGRVDLPLPPEVWTAALRAGYVGCVRDLFIDGRSRD
LRGLAEAQGAVGVAPFCSRETLKQCASAPCRNGGLCREGWNRFVCDCIGTGFLGRVCERE
ATVLSYDGSMYMKIMLPNAMHTEAEDVSLRFMSQRAYGLMMATTSRESADTLRLELDGGQ
MKLTVNLDCLRVGCAPSKGPETLFAGHKLNDNEWHTVRVVRRGKSLQLSVDNVTVEGQMA
GAHTRLEFHNIETGIMTERRFISVVPSNFIGHLSGLVFNGQPYMDQCKDGDITYCELNAR
FGLRAIVADPVTFKSRSSYLALATLQAYASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIE
LVKGYIHYVFDLGNGPSLMKGNSDKPVNDNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNG
ARNLDLKGELYIGGLSKNMFNNLPKLVASRDGFQGCLASVDLNGRLPDLIADALHRIGQV
ERGCDGPSTTCTEESCANQGVCLQQWDGFTCDCTMTSYGGPVCNDPGTTYIFGKGGALIT
YTWPPNDRPSTRMDRLAVGFSTHQRSAVLVRVDSASGLGDYLQLHIDQGTVGVIFNVGTD
DITIDEPNAIVSDGKYHVVRFTRSGGNATLQVDSWPVNERYPAGNFDNERLAIARQRIPY
RLGRVVDEWLLDKGRQLTIFNSQAAIKIGGRDQGRPFQGQVSGLYYNGLKVLALAAESDP
NVRTEGHLRLVGEGPSVLLSAETTATTLLADMATTIMETTTTMATTTTRRGRSPTLRDST
TQNTDDLLVASAECPSDDEDLEECEPSTGGELILPIITEDSLDPPPVATRSPFYPFLTGV
GATQDTLPPPAARRPPAGGPCQAEQDDSDCEEPIEASGFASGEVFDSSLPPTDDEDFYTT
FPLVTDRTTLLSPRKPAPRPNLRTDGATGAPGVLLAPSAPAPNLPAGKMNHRDPLQPLLE
NPPLGPGAPTSFEPRRPPPLRPGVTSAPGFPRLPTANPTGPGERGPPGAVEVIRESSSTT
GMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVKEKAPAAP
KTPSKAKKNKDKEYYV
Download sequence
Identical sequences ENSSSCP00000013851 ENSSSCP00000013851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]