SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013872 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013872
Domain Number 1 Region: 46-271
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-73
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.000000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013872   Gene: ENSSSCG00000013045   Transcript: ENSSSCT00000014258
Sequence length 271
Comment pep:known chromosome:Sscrofa10.2:2:7204713:7212472:-1 gene:ENSSSCG00000013045 transcript:ENSSSCT00000014258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSERLELSVLYKE
YAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
SKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTS
GYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGE
GGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
Download sequence
Identical sequences A0A212DGD5 A0A2K5C9E2 A0A2K5U6Q4 A0A2K5ZSA6 A0A2K6DPN6 A0A2K6MWA7 A0A2K6R774 A0A2K6SFA1 C5H0C6 F6QN11 H0WVM7 I0FT81 K7C2Z7 L9KQT1 M3XBE5 M3YPF8 Q96FW1
NP_001155875.1.46622 NP_060140.2.87134 NP_060140.2.92137 XP_002755508.1.60252 XP_003798644.1.62490 XP_003937687.1.74449 XP_004394080.1.74151 XP_004770259.1.14098 XP_006149875.1.99106 XP_006746290.1.47382 XP_006911229.1.64745 XP_007174399.1.59432 XP_008952193.1.60992 XP_009244482.1.23681 XP_010375138.1.97406 XP_011285283.1.62641 XP_011367009.1.92234 XP_011718870.1.29376 XP_011848843.1.47321 XP_012318546.1.9421 XP_014969403.1.72884 XP_015290036.1.63531 XP_015974007.1.101085 XP_016776623.1.37143 XP_017748118.1.44346 XP_020743358.1.74333 XP_021541187.1.83697 ENSCJAP00000033857 ENSMPUP00000013216 ENSMPUP00000013216 ENSP00000402551 ENSP00000444357 ENSOGAP00000006373 ENSOGAP00000006373 9600.ENSPPYP00000003605 9606.ENSP00000301453 9823.ENSSSCP00000013872 GO.34716 HR2164 ENSSSCP00000013872 ENSSSCP00000013872 gi|109148508|ref|NP_060140.2| ENSP00000402551 ENSP00000444357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]