SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013885 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013885
Domain Number 1 Region: 23-159
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-40
Family Galectin (animal S-lectin) 0.00023
Further Details:      
 
Domain Number 2 Region: 187-314
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.61e-17
Family Galectin (animal S-lectin) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013885   Gene: ENSSSCG00000013056   Transcript: ENSSSCT00000014271
Sequence length 314
Comment pep:known chromosome:Sscrofa10.2:2:7840929:7852494:1 gene:ENSSSCG00000013056 transcript:ENSSSCT00000014271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGEKLDPLPDTFILQPPVFHPVVPYVTTIFGGLRAGKMVQLQGVVPLDARRFQVDFQC
GCSLHPRPDIAIHFNPRFHTTKPHVICNTLQGGHWQAEARWPHLALQRGASFLILFLFGN
EEMKVSVNGLHFLHYRYRLPLSRVDTLGIYGDILVTAVGFLNINPFVEGGSEYPVGHPFL
LKSPRLEVPCSRALPRGLWPGQVIIVRGLVLPEPKDFTLRLRDEAAHVPVTLRASFADRT
LAWVSRWGGKKLIPAPFLFYPQRFFEVLLLCQEGGLKLALNGQGLGATSLGPQALERLRE
LHISGSIQLYCVHY
Download sequence
Identical sequences B7U2G9
NP_001136316.1.46622 ENSSSCP00000013885 ENSSSCP00000013885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]