SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013927 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013927
Domain Number 1 Region: 125-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 382-441
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.017
Further Details:      
 
Domain Number 3 Region: 493-561
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000178
Family VWC domain 0.028
Further Details:      
 
Domain Number 4 Region: 678-743
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000659
Family VWC domain 0.0064
Further Details:      
 
Domain Number 5 Region: 627-687
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000994
Family VWC domain 0.0066
Further Details:      
 
Domain Number 6 Region: 567-625
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000022
Family VWC domain 0.011
Further Details:      
 
Domain Number 7 Region: 434-495
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000303
Family VWC domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013927   Gene: ENSSSCG00000013093   Transcript: ENSSSCT00000014313
Sequence length 946
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:9754129:9786173:1 gene:ENSSSCG00000013093 transcript:ENSSSCT00000014313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAGLLLQAACVALLLPGTPARGYTGRKTPGHFGAERRRLGPHVCLSGFGSGCCPGWAPS
MGSGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGATCPEAHGPCGEYGCDLTCNHGGCQE
VARVCPVGFSMTETAVGIRCTDIDECLSASCEGHCVNTEGGFVCECGPGMQLSADRHSCQ
DTDECLGTPCQQRCKNSIGSYRCSCRTGFHLHGNRHSCVDVNECRRPLERRVCHHSCHNT
VGSFLCTCRPGFRLRADRVSCEAFPKAVLAPSAILQPLQHPPKMLLLLPEAGRPALSPGH
SPPSGAPGPPPGVRTTRLPFPTPVLPTASPSALSQLLSTTVATPVLSASLLGTLGPPSQL
QEKAVVTPSLPRGPEATQLAPGPSACWHLGAMYESGSRWTEPDCSQCSCEDGEVTCAKVT
CEAVCSHPLPSGDGGCCPSCAGCFHSGVVRAEGDVFSPPNQNCTICVCLAGNVSCISPEC
PPGPCQTSLKSDCCTCVPVRCYFHGRWYADGAVFSGGGDECTTCVCQNGEVECSFTPCPE
LGCPREEWWLGPGQCCFTCREPTPMTGCSLDDNGVEFPIGQIWSPGDPCELCICQADGSV
SCKRTDCVDSCPHPIRIPGQCCPDCSAGCTYTGRIFYNNQTFPSVLDPCLSCICLLGSVA
CSPVDCPITCTYPFHPDGECCPVCRDCNYEGRKVANGQVFTLDDEPCTQCICQLGEVSCE
KMPCQQACADSSLPPRDCCSSCPVGLRPDFLEGSRGLSPGGVAELSKASRSPRGDPEAPV
NCSSCPGPPATSSQRPAPQLLQLLLRTNLSNRQTLPSGARASPSPHLRLEGNFPGEPGAS
QPPRLSPGPSIFPGASSLPPASPGAPGPPPLTPEPSSSASRAHTASRRPTTALPGASALS
TMGTSPSETPVTLLRPRRLSAALAATGSPGPQPPTTGTSREEEPTG
Download sequence
Identical sequences ENSSSCP00000013927 ENSSSCP00000013927 9823.ENSSSCP00000013927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]