SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013978 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013978
Domain Number 1 Region: 330-489,529-602
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.38e-24
Family Viral proteases 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013978   Gene: ENSSSCG00000013146   Transcript: ENSSSCT00000014366
Sequence length 610
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:11866314:11871396:-1 gene:ENSSSCG00000013146 transcript:ENSSSCT00000014366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKEPRSQMNSDEKNNTGDCYFSKVNENQQNNCSTSPMKMDSRNISESIPSTQAEGPKD
QTVSQNKVIYVHFAVNSRTHKNRPYEVSSKDGETLYMALQKLKAVTDEIKTHSGQEMLVC
GTEGIEGYLNLSMPIRCFPKSCHVKIDFAKSQSQQTEENQEEDQEENQHNNASTDCVKFY
IHAVGKTKRKIVKCGMLRKEGNRLCVYAFKGKSIKSALCEDGRFLSILKNDNWKLIEKLN
VVLESSRLVDDLEGKSFQVEFDRKVGTGADATRNSESQKINPRVLKETIADRYPSLKKER
DKIRESFKKSMERGKGKKLFESHKTDFGNLTKNSTLVRVHRLLCHRSESVGYLSWDNRGE
KGSATCFVFRELYIFTCLHVINEIVREEIDETKWENIISQCVRVTFVYEKAGEEKQKSFC
IEPWFEIFDANLDYVVLKLKTNGQQVPVGLYNEIAQSDPEPPKGLVYMIGHPDGEAKTTD
ACAVISHGRQEEDQEQPPAGEAEGRGYDMRYIHMHTQKSFQEIVPNPEGVTSNTSFYVGS
SGSPVFDSEVSLVAMLTAGFSYEYQKGTSSIIEFGSTLKSILSHIKQNHGRWYETLSVNP
YNVKKDKINN
Download sequence
Identical sequences ENSSSCP00000013978 9823.ENSSSCP00000013978 ENSSSCP00000013978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]