SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013979 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013979
Domain Number 1 Region: 438-594,635-694
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.39e-26
Family Prokaryotic proteases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013979   Gene: ENSSSCG00000013147   Transcript: ENSSSCT00000014367
Sequence length 732
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:11881575:11892422:-1 gene:ENSSSCG00000013147 transcript:ENSSSCT00000014367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFMKAEENKSFSTVGNDLSTGPEISKDTTMQQTCSDTPADQLLANLQVSIRTIKIKSEV
SEQKISPESQNPHLSTSKKYFTFMLQIGSRKSDQTRKTAHGGLNENIDSALKNNEHFRRH
VQDPFKWNIMAYEETTIKGFVNLGMPLRCLPEKSHFKITIVPRKSKQENYDPMLRLCENP
DIECILFHVLSIGKNIKKIVKIMDLHEKGSKLCVYAFKGETIKEALCKDGRFRSDLDSLE
WELVEGHQNVHGKESTVDQISGKLLEMEVLIKKDKKKGTGTKIKQRNENATDEINHRDSI
WSKSTVHEPGPNGETEDTEHNREKILPFQSLESKKHRTISEIKGYYDGSFNTSCMGETSQ
VRLRSPLPIECAFYTDRQKEATNSWKKNVKILGKAIMHRYPFFNEEVLRVRKYLEEEQKR
NLPPFEQFNIYKEYFGKVTENSTSVETCERLIHHSESVGFMKWDVNGNSGSATCFVIKNG
YIFTCRHVLDLILRDSTNPSLQLDIISSCVKVTFSYKSFCPKDNDWFSLEKCFAVSDETL
DYAILKLSKNGHRFPPGLFQHVSPQPSGGLIYLIGHPEGQIKKIDGCMVIPLEQRLESYP
ENHRDRVAGTHAPIYNACPVLTQRSFLTEAWSRETLSYDTCFSSGSSGSPVFNASGRLVA
MHSFGHFYRHENKVYALIEFGYSMDSILSDIKRKHERLYKLLEEEENENHEEERENTRES
SLRDHQVEPMEH
Download sequence
Identical sequences F1RMF9
9823.ENSSSCP00000013979 ENSSSCP00000013979 XP_003353909.1.46622 XP_005660933.1.46622 XP_013849754.1.46622 XP_020938656.1.46622 ENSSSCP00000013979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]