SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014051 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000014051
Domain Number - Region: 882-938
Classification Level Classification E-value
Superfamily HCP-like 0.0188
Family HCP-like 0.016
Further Details:      
 
Domain Number - Region: 214-324
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0738
Family Quinoprotein alcohol dehydrogenase-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014051   Gene: ENSSSCG00000013223   Transcript: ENSSSCT00000014443
Sequence length 1439
Comment pep:known chromosome:Sscrofa10.2:2:15899095:15950508:-1 gene:ENSSSCG00000013223 transcript:ENSSSCT00000014443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLHLSASVLAPPPEVTTAARLGWCPVRPRGGGGGKMAAAGAMERSFVELSGAERERPRHF
REFAVCDIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELVEESL
DVNLLNNAVRLKFQNCSLLPGGVHVAETQNHVILLILTNQTVHRLLLPHPSRMYRSELVI
ESQMQSVFTDIGKFDFRDPYNYQLIPAAPGLSPNSTTSAAWLSNDGEALFALPSASGGIF
VLKLPPYDVPGMVSVVELKQSSVMQRLLIGWMPTAIRGDQGPSDRPLSLAVHCVEHDAFI
FALCQDHKLRMWSYKDQMCLMVADMLEYVPVNKDLRLTAGTGHKLRLAYSPSMGLYLGIY
MHAPKRGQFCVFQLVSTENSRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTIV
KYINFEHNVAGQWNPVFIQPLPEEEIIIRDDQDPREMYLRSLFTPGRFTNAALCKALQIF
CRGTERNLDLSWSELKREVTLAVESELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQ
EALSHPLALHLNPHTNMVCLLKKGYLSFLVPSSLVDHLYLLPDENLLTEDETTISDVIDV
DVARDVICLIKCLRLIGESVTMDMSVMMEMSCYNLQSPEKAAEQILEDLITIDVDNVMED
ICSKLQEIRNPIHAIGLVIREMDYETEVEMEKGFNPAQPLNIRMNLSQLYGSSTAGYIVC
RNVCKIASTRFLICRDLLILQQLLMRLGDAVILGAGQLFQAQQDLLHRTAPLLLSYYLIK
WGSQCLATDVPVDTLESNLQHLSVLELTDSGTLTANKFVSSPQTIVELFFQEVARKHIIS
HLFSQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQL
LHPWCQVNVGSCRFMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVST
PRLQYYDKVLRLLDVVGLPELVIQLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQA
YEALTQIPDSSRQLDCLRQLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMT
HNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEKQGNCYLAAINCLRLIRP
EYAWIVQPASGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLARIRLTLA
QHDPSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGG
EPAQAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSH
GVPLPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSA
TAPMVWLPYSSIDQLLQALGENSANSHNIALSQKILDKLEDYQQKVDKATRDLLHRRLL
Download sequence
Identical sequences ENSSSCP00000014051 ENSSSCP00000014051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]