SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014076 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014076
Domain Number 1 Region: 434-690
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1348-1605
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-57
Family YWTD domain 0.0000034
Further Details:      
 
Domain Number 3 Region: 736-992
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-55
Family YWTD domain 0.00000139
Further Details:      
 
Domain Number 4 Region: 1043-1296
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-48
Family YWTD domain 0.00000334
Further Details:      
 
Domain Number 5 Region: 257-297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 6 Region: 136-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 7 Region: 221-259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 1302-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000745
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 302-338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 351-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000107
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 100-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 12 Region: 59-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 13 Region: 692-729,987-1038
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000487
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 14 Region: 180-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 381-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 16 Region: 19-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000014076
Domain Number - Region: 1605-1643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014076   Gene: ENSSSCG00000013248   Transcript: ENSSSCT00000014468
Sequence length 1898
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:16981002:17020205:-1 gene:ENSSSCG00000013248 transcript:ENSSSCT00000014468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALTGSFSLCPGLASSPDCACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCM
LPTCSPLDFPCDNGKCIRRSWVCNGDNDCEDDSDEPGLSPRECEEDEFPCQNGYCIRSLW
HCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEENCPSAVP
APPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAG
WRCDGDADCDDQSDERNCTTSVCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENT
GSPQCASDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCNVNNGGCSQ
KCQMVRGAVQCTCHTGYRLTEDGRMCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELR
PDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDV
TLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKV
LLWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDY
AGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSAN
KFTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTG
FRKISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHV
YWTDVSTDAISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDG
SMRTVLIWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNG
LAIDYGSQRLYWADAGMKTIEFSGLDGSKRKVLIGSQLPHPFGLTLYGDRIYWTDWQTKS
IQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCATENGGCSHLCLRSPSPSGFS
CTCPTGINLMPDGKTCSPGMNSFLIFARRIDIRMVSLDILYFADVVVPINITMKNTIAIG
VDPQEGKVYWSDSTLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNR
IEVGNLDGSMRKVLVWQNLDSPRAIVLYHEKGFMYWTDWGEHAKLERSGMDGSDRTVLIN
HNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGASRHTLVSPVQHPYGLTLLDSYIYW
TDWQTRSIHRADKGTGGNVILVRSNLPGLMDIQAVDRAQPLGFNKCGSRNGGCSHLCLPR
PSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNV
ISLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDT
GRNTIEASRLDGSCRKVLVNNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERK
VLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLSGKLRQVLVSHVSHPFALTQQDR
WIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHL
CFARTSDFVCACPDEPDGRPCSLVPGLVPPAPRATSTSERSPVLPNTLPTTLRSSTTRTR
TSLEDMEGRCSEKDAQLGLCAQSNEAIPAAPGEGLHVSYVIGGLLSILLILVVIAAFMLY
RHKKSKLTDPGMGNLTYSNPSYRTSTQEVKIEAVPKPAMYNQLCYKKEGGPDHNYTKEKV
KIVEGICLLSGEDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQ
EEQSECGSVHTAATPERRGSLPDTGWRHECKLSSESQV
Download sequence
Identical sequences ENSSSCP00000014076 9823.ENSSSCP00000014076 ENSSSCP00000014076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]