SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014081 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014081
Domain Number 1 Region: 341-619
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-86
Family Eukaryotic proteases 0.000000000791
Further Details:      
 
Domain Number 2 Region: 104-193
Classification Level Classification E-value
Superfamily Kringle-like 2.34e-32
Family Kringle modules 0.00000586
Further Details:      
 
Domain Number 3 Region: 210-298
Classification Level Classification E-value
Superfamily Kringle-like 6.77e-27
Family Kringle modules 0.00000766
Further Details:      
 
Domain Number 4 Region: 45-103
Classification Level Classification E-value
Superfamily GLA-domain 4.21e-18
Family GLA-domain 0.0000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014081   Gene: ENSSSCG00000013252   Transcript: ENSSSCT00000014473
Sequence length 623
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:17145002:17170975:-1 gene:ENSSSCG00000013252 transcript:ENSSSCT00000014473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVGGLWLPGCLALAVLVSLVHSQHVFMAPQQALSLLQRARRANSGFFEEMRKGNLERE
CVEEHCSREEAYQVLESPSETDAFWAKYTACESVRKSREKLVECLEGNCAEGLGMNYRGN
ISVTRSGIECQLWRSRYPHKPEVNSTMYPGADLRENFCRNPDGSITGPWCYTTSPTVRRE
ACSIPVCGQGRVTAELIPRSGGSTVNVSPPLETCVPERGRQYQGRLAVTSHGSPCLAWGS
SQAKALSKDQDFNPAVPLVENFCRNPDGDQEGAWCYVAGQPGDFEYCDLDYCEEPVDEEV
GDALGENADAAIEGRTTADDFQPFFNEKTFGAGEADCGLRPLFEKSSLEDKTEKELFESY
IEGRIVEGSDAEIGLAPWQVMIFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTE
NDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALLKLRKPITFSDYIH
PVCLPDKETATKLLRAGYKGRVTGWGNLKETWTTSASEVQPSVLQVVNLPIVERLVCKAS
TRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGK
YGFYTHVFRLKKWMQKVIDRFGG
Download sequence
Identical sequences ENSSSCP00000014081 ENSSSCP00000014081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]