SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014200 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014200
Domain Number 1 Region: 160-220
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.5e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000014200
Domain Number - Region: 73-150
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00136
Family FCH domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014200   Gene: ENSSSCG00000013364   Transcript: ENSSSCT00000014595
Sequence length 227
Comment pep:known chromosome:Sscrofa10.2:2:43759302:43783739:-1 gene:ENSSSCG00000013364 transcript:ENSSSCT00000014595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGMPSGISAYPSGYPPNPSGYPGCPYPPGGQYPATTSSQYPSQPPVTTVGPSRDGTISE
DTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAE
VDKNIELLRKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIF
YLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSSSCP00000014200 ENSSSCP00000014200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]