SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014240 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014240
Domain Number 1 Region: 72-143
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.88e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 156-210,238-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.45e-17
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014240   Gene: ENSSSCG00000013397   Transcript: ENSSSCT00000014635
Sequence length 273
Comment pep:novel chromosome:Sscrofa10.2:2:49317637:49340140:-1 gene:ENSSSCG00000013397 transcript:ENSSSCT00000014635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGATDLLSSPLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKK
Download sequence
Identical sequences 9823.ENSSSCP00000014240 ENSSSCP00000014240 ENSSSCP00000014240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]