SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014247 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014247
Domain Number 1 Region: 2-133,189-273
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-60
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000953
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000014247
Domain Number - Region: 440-503
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000871
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014247   Gene: ENSSSCG00000013402   Transcript: ENSSSCT00000014642
Sequence length 1084
Comment pep:known chromosome:Sscrofa10.2:2:50763080:50825362:-1 gene:ENSSSCG00000013402 transcript:ENSSSCT00000014642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPE
ILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEE
LDMSTFIDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLENNSGTEK
ISKPGLEKNSLIYELFSVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKK
THGGSSGSRGYYSSAFASSTNAYMLIYRLKDPARNAKFLEVDEYPEHIKNLVQRERELEE
QEKRQREIERNTCKIKLFCLHPVKQIMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPMD
CCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRRPDQVFQSYKPGDV
TEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQLISKAIHLPAETMRIVLERCYNDL
RLLTVPSKTLKAEGFFRSNKVFVESSETVDHQMAFTDSHLWKLLDRHANTIRLFVLLPEQ
SPGSYSKRTAYQKAGGDSGNVDDDCERVKGPAGSLKSVEAILEESTEKLKSLSLQQQQEG
DNGDSSKSTETSDFENIESPLNERDSSASVDNRELEQHIPTSDPENFQSEERSDSDVNND
RSTSSVDSDILSSSHSSDTLCNADNAQIPLANGLDSHSITSSRRTKANEGKKETWDTAEE
DSGTDSEYDESGKSRGEIQYMYFKAEPYAADEGSGEGHKWLMVHVDKRITLAAFKQHLEP
FVGVLSSHFKVFRVYASNQEFESVRLNETLSSFSDDNKITIRLGRALKKGEYRVKVYQLL
VNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFL
DYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWRPSEMKLDPFQEVVLESSS
VDELREKLCEISGIPLEDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDD
GAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKD
LTQD
Download sequence
Identical sequences ENSSSCP00000014247 ENSSSCP00000014247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]