SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014261 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014261
Domain Number 1 Region: 61-237
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.57e-38
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 2 Region: 219-324
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000000000000144
Family Ypt/Rab-GAP domain of gyp1p 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014261   Gene: ENSSSCG00000013413   Transcript: ENSSSCT00000014656
Sequence length 357
Comment pep:novel chromosome:Sscrofa10.2:2:53331522:53338125:1 gene:ENSSSCG00000013413 transcript:ENSSSCT00000014656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEIIASYEQGHKSGSPADPWDDADLLLYKVTDRLGFFAPCVLHTRIGYPSSRVRVRAQPA
TKWVKMLRNWSKYQGNQKMRQWVCKGIPPQVRGQAWSLLLDLEKVKVETQGKYQRMKEQA
RLFSLDIKFIDMDMSHTFQNNIMLREHYGIKQQALLNVLTAYSVYKKEVGYCQGMNQIVT
ILLMFLNEEDAFWALAQMMDNKKHAVHGFFILRFPKLQRLQAHYDILDRTLPKLKWHLDK
EYMFTASYTMLWFQQCFTDHTPFSLTLRLWINTSWRASILTAIAYTVIKLHRKCLLKLPL
DGLHEFLQDTLSRPWALDDDVMIKGLQASMTELHRGKHGKSPRTEPEEFPMRPLGLE
Download sequence
Identical sequences 9823.ENSSSCP00000014261 ENSSSCP00000014261 ENSSSCP00000014261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]