SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014266 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014266
Domain Number 1 Region: 23-250
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.14e-67
Family Eukaryotic proteases 0.00000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014266   Gene: ENSSSCG00000013417   Transcript: ENSSSCT00000014661
Sequence length 256
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:77474233:77477177:1 gene:ENSSSCG00000013417 transcript:ENSSSCT00000014661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSCRPSSPALAPVLLALLLGGAARAVEIVGGQEAQPHSRPYVASLQLPWPPNSHFCGG
TLIHPSFVLTAAHCLNTMNPTRVNVVLGAHNLQTPEPTQQIFRIARLFENNYDPQQKLND
VLLLQLDRPATLNTQVAVAQLPQQDQLLPHGTRCLAMGWGRLGTLEPQPRVLQELNVTVV
TFLCRPQNVCTFVPQRSAGICFGDSGGPLICDGVLQGVDSFVIRGCATGQFPDFFARVAL
YVNWIHSVLRSVGGED
Download sequence
Identical sequences ENSSSCP00000014266 ENSSSCP00000014266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]