SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014267 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014267
Domain Number 1 Region: 17-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2e-75
Family Eukaryotic proteases 0.0000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014267   Gene: ENSSSCG00000013418   Transcript: ENSSSCT00000014662
Sequence length 259
Comment pep:known chromosome:Sscrofa10.2:2:77485872:77487847:1 gene:ENSSSCG00000013418 transcript:ENSSSCT00000014662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRSGHLAALILLGAAVCVAQPRGRILGGQEAKSHERPYMASVQVNGKHVCGGFLVSEQ
WVLSAAHCLEDVAEGKLQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLK
LSEKAELGPAVQPLAWQREDHEVPAGTLCDVAGWGVVSHTGRRPDRLQHLLLPVLDRTTC
NLRTYHDGTITERMMCAESNRRDSCKGDSGGPLVCGGVAEGVVTSGSRVCGNRKKPGIYT
RLASYVAWIDGVMADSAAA
Download sequence
Identical sequences P51779
ENSSSCP00000014267 ENSSSCP00000014267 XP_013850255.1.46622 9823.ENSSSCP00000014267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]