SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014282 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014282
Domain Number 1 Region: 357-477
Classification Level Classification E-value
Superfamily TIMP-like 1.88e-21
Family Tissue inhibitor of metalloproteinases, TIMP 0.0077
Further Details:      
 
Domain Number 2 Region: 42-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000536
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014282   Gene: ENSSSCG00000013433   Transcript: ENSSSCT00000014677
Sequence length 482
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:78106737:78112308:-1 gene:ENSSSCG00000013433 transcript:ENSSSCT00000014677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGLRLLGSSARYQTQPHLPHQNLLLLWTLLNSGLGGNAQGPGEWTPWGSWSRCSSSCGR
GLSVRSRRCIRFPQEELCWGDTHEYRVCQLPDCPPGAVPFRDLQCALYNGLPVLGTQKTY
QWVPFYGAPNQCDLNCLAEGHDFYHSFGRVLDGTPCSPGTQGLCVAGRCLSAGCDGLLGS
DAREDQCGHCGGANDSCLFVQRVFRDAGAFAGYWNVTLIPEGARHIRAAHWSRNHLALMG
VDGYYVLNGNWVVSPPGTYEAAGTHVVYTRAATGPEETLRATGPTSQDLLLQVLLQEPNP
GIEFEFWLPRERYGPFQAQAQALGWSLRQPQPREVDLQPPEPPPAPTVIPSRTPIPTPEP
CPPCPDTRGRAHRLLHYCGSDFVFRARVLGRLHQAQETRYEVRVQLIYKNRSPLQALEYV
WAPSRCPCPLLALHREYLLAAQRLISPDGTQDRLLLPHAGYARPWSPAEDSRTRLVARHC
PL
Download sequence
Identical sequences ENSSSCP00000014282 ENSSSCP00000014282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]